PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c26_1390V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 571aa    MW: 62474.4 Da    PI: 7.2653
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c26_1390V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.1e-181461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g W++eEde+lv++v+++G g+W+ +++  g+ R++k+c++rw +yl
  Pp3c26_1390V3.1.p 14 KGLWSPEEDEKLVRYVTKHGHGCWSVVPKQAGLQRCGKSCRLRWINYL 61
                       678*******************************************97 PP

2Myb_DNA-binding45.32e-1467110146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg +++ E+ l++d+++ lG++ W+ Ia  ++ gRt++++k++w++
  Pp3c26_1390V3.1.p  67 RGVFSAAEENLIIDLHAVLGNR-WSQIATQLP-GRTDNEIKNFWNS 110
                        899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.688965IPR017930Myb domain
SuperFamilySSF466894.87E-2911108IPR009057Homeodomain-like
SMARTSM007174.7E-141363IPR001005SANT/Myb domain
PfamPF002492.4E-161461IPR001005SANT/Myb domain
CDDcd001673.43E-121761No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129419.86566116IPR017930Myb domain
SMARTSM007171.4E-1366114IPR001005SANT/Myb domain
PfamPF002491.0E-1267110IPR001005SANT/Myb domain
CDDcd001678.92E-1070109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MGRHSCCHKQ KLKKGLWSPE EDEKLVRYVT KHGHGCWSVV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGVF SAAEENLIID LHAVLGNRWS QIATQLPGRT DNEIKNFWNS CIKKKLRNIG  120
IDPSTHKLVG SDSSAFLGES SSSEINPKSE CHRSTSSNSH VITGSSTGFV RFTNSEFKAQ  180
SLFHPQASHN PFIPMEEVMY NPTRSLIHQQ PPRDRHFMGF NQLQGNGLST DNLLERLMMT  240
GKHSRGLPPK APSWMPHLTG SLDRDDNGPK PIHQPSTLVP PAFNPVFWLL QSGAVSSSEP  300
GGGGSDPFPV HAQHGAPEIE MRLGPFAPNS SGTSHDYHGG SFQDLLQDPG DLSSITANLQ  360
LRSGAGPAHE DAVNVGNARV QRPFRWEGHN GSEPSSSSTS NETGISPPGS HLMFQETGGN  420
QPWSSADTDP SPSALKSCSL SAQTTEEPST RSRFSSNHEP SDCDTVMKWC ALLPTQGQNH  480
CIDQLPASAR NAPVQHHEHN PRQNHADQLS QSQMDHPLGN GSSGNVQFTL TSHCMNWQMH  540
ASHGGQDAMF DSVAPMSQEL QRMAAVLDQI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-28121165108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S149_164V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.33e-80myb domain protein 55